Make your own free website on Tripod.com

Where's the Problem?

Home
Chromosome 11 Interesting Information
Where's the Problem?
What Can We Do?
Further Study and Thanks to

Myelogenous Leukemia

The marrow protein is coded in 4102 bases. The cause of Leukemia is in a deletion of the 3014th-3017th bases,  in the marrow protein. The lack of these bases is not always present in every cell. Replication is often the cause of the deletion. Due to the deletion, every one of the 182 proceeding amino acids are changed. This explains the extreme differance in size of the two cells. After these cells replicate, they are attracted to the healthy cells and "choke them out". Below, the correct base code is provided with the four bases that would be deleted highlighted in red. Below that is the amino acid chain with the incorrect amino acids highlighted. To the right is an amino acid key but I know you have it memorized!

cggcggcagt gtctgtggtg gccgcggcgg  cgagagcgac ggtcccatct ttcccaccct
cttggttgcc gctggccaca cgccctccgc
tggcggcgac ttctcagctc cgtgcgcccg
ggctggacag tgagcctcga gaggagacgc
gggcggctag agccggagtg gggcgagccg
cggaacccgg ccgggagccg cgcgaggcgt
gatcggaggg tatggttggc atggaattga
atttcatctg tctgtgggaa ttgtaagcaa
gattgccatc acgaaagcca aagtggattt
ctccagtgtg gtgtgcctgc ccccttccgt
cattgctgtg aatgggctgg acggaggagg
ggccggcgaa aatgatgatg aaccagtgct
cgtgtcctta tctgcggcac ccagtcccca
gagtgaagct gttgccaatg aactgcagga
gctctccttg cagcccgagc tgaccctagg
cctccaccct ggcaggaatc ccaatttgcc
tccacttagt gagcggaaga atgtgctaca
gttgaaactc cagcagcgcc ggacccggga
agaactggtg agccaaggga tcatgccgcc
tttgaaaagt ccagccgcat ttcatgagca
gagaaggagc ttggagcggg ccaggacaga
ggactatctc aaacggaaga ttcgttcccg
gccggagaga tcggagctgg tcaggatgca
cattttggaa gagacctcgg ctgagccatc
cctccaggcc aagcagctga agctgaagag
agccagacta gccgatgacc tcaatgagaa
gattgcacag aggcctggcc ccatggagct
ggtggagaag aacatccttc ctgttgagtc
cagcctgaag gaagccatca ttgtgggcca
ggtgaactat cccaaagtag cagacagctc
ttccttcgat gaggacagca gcgatgcctt
atcccccgag cagcctgcca gccatgagtc
ccagggttct gtgccgtcac ccctggaggc
ccgagtcagc gaaccactgc tcagtgccac
ctctgcatcc cccacccagg ttgtgtctca
acttccgatg ggccgggatt ccagagaaat
gcttttcctg gcagagcagc ctcctctgcc
tcccccacct ctgctgcctc ccagcctcac
caatggaacc actatcccca ctgccaagtc
cacccccaca ctcattaagc aaagccaacc
caagtctgcc agtgagaagt cacagcgcag
caagaaggcc aaggagctga agccaaaggt
gaagaagctc aagtaccacc agtacatccc
cccggaccag aagcaggaca ggggggcacc
ccccatggac tcatcctacg ccaagatcct
gcagcagcag cagctcttcc tccagctgca
gatcctcaac cagcagcagc agcagcacca
caactaccag gccatcctgc ctgccccgcc
aaagtcagca ggcgaggccc tgggaagcag
cgggaccccc ccagtacgca gcctctccac
taccaatagc agctccagct cgggcgcccc
tgggccctgt gggctggcac gtcagaacag
cacctcactg actggcaagc cgggagccct
gccggccaac ctggacgaca tgaaggtggc
agagctgaag caggagctga agttgcgatc
actgcctgtc tcgggcacca aaactgagct
gattgagcgc cttcgagcct atcaagacca
aatcagccct gtgccaggag cccccaaggc
ccctgccgcc acctctatcc tgcacaaggc
tggcgaggtg gtggtagcct tcccagcggc
ccggctgagc acggggccag ccctggtggc
agcaggcctg gctccagctg aggtggtggt
ggccacggtg gccagcagtg gggtggtgaa
gtttggcagc acgggctcca cgccccccgt
gtctcccacc ccctcggagc gctcactgct
cagcacgggc gatgaaaact ccacccccgg
ggacaccttt ggtgagatgg tgacatcacc
tctgacgcag ctgaccctgc aggcctcgcc
actgcagatc ctcgtgaagg aggagggccc
ccgggccggg tcctgttgcc tgagccctgg
ggggcgggcg gagctagagg ggcgcgacaa
ggaccagatg ctgcaggaga aagacaagca
gatcgaggcg ctgacgcgca tgctccggca
gaagcagcag ctggtggagc ggctcaagct
gcagctggag caggagaagc gagcccagca
gcccgccccc gcccccgccc ccctcggcac
ccccgtgaag caggagaaca gcttctccag
ctgccagctg agccagcagc ccctgggccc
cgctcaccca ttcaacccca gcctggcggc
cccagccacc aaccacatag acccttgtgc
tgtggccccg gggcccccgt ccgtggtggt
gaagcaggaa gccttgcagc ctgagcccga
gccggtcccc gccccccagt tgcttctggg
gcctcagggc cccagcctca tcaagggggt
tgcacctccc accctcatca ccgactccac
agggacccac cttgtcctca ccgtgaccaa
taagaatgca gacagccctg gcctgtccag
tgggagcccc cagcagccct cgtcccagcc
tggctctcca gcgcctgccc cctctgccca
gatggacctg gagcacccac tgcagcccct
ctttgggacc cccacttctc tgctgaagaa
ggaaccacct ggctatgagg aagccatgag
ccagcagccc aaacagcagg aaaatggttc
ctcaagccag cagatggacg acctgtttga
cattctcatt cagagcggag aaatttcagc
agatttcaag gagccgccat ccctgccagg
gaaggagaag ccatccccga agacagtctg
tgggtccccc ctggcagcac agccatcacc
ttctgctgag ctcccccagg ctgccccacc
tcctccaggc tcaccctccc tccctggacg
cctggaggac ttcctggaga gcagcacggg
gctgcccctg ctgaccagtg ggcatgacgg
gccagagccc ctttccctca ttgacgacct
ccatagccag atgctgagca gcactgccat
cctggaccac cccccgtcac ccatggacac
ctcggaattg cactttgttc ctgagcccag
cagcaccatg ggcctggacc tggctgatgg
ccacctggac agcatggact ggctggagct
gtcgtcaggt ggtcccgtgc tgagcctagc
ccccctcagc accacagccc ccagcctctt
ctccacagac ttcctcgatg gccatgattt
gcagctgcac tgggattcct gcttgtagct
ctctggctca agacggggtg gggaaggggc
tgggagccag ggtactccaa tgcgtggctc
tcctgcgtga ttcggcctct ccacatggtt
gtgagtcttg acaatcacag cccctgcttt
ttcccttccc tgggaggcta gaacagagaa
gcccttactc ctggttcagt gccacgcagg
gcagaggaga gcagctgtca agaagcagcc
ctggctctca cgctggggtt ttggacacac
ggtcagggtc agggccattt cagcttgacc
tccttttttg aggtcagggg gcactgtctg
tctggctaca atttggctaa ggtaggtgaa
gcctggccag gcgggaggct tctcttctga
cccagggctg agacaggtta aggggtgaat
ctccttcctt tctctccctg ctttgctgtg
aagggagaaa ttagcctggg cctctacccc
ctattccctg tgtctgccaa ccccaggatc
ccagggctcc ctgccatttt agtgtcttgg
tgtagtgtaa ccatttagtg gttggtggca
acaattttat gtacaggtgt atatacctct
atattatata tcgacataca tatatatttt
tggggggggg cggacaggag atgggtgcaa
ctccctccca tcctactctc acagaagggc
ctggatgcaa ggttaccctt gagctgtgtg
ccacagtctg gtgcccagtc tggcatgcag
ctacccaggc ccacccatca cgtgtgattg
acatgtaggt accctgccac ggcctatgcc
ccacctgccc tgcttcctgg ctccttatca
gtgccatgag ggcagaggtg ctacctggcc
ttcctgccag gagctctcca cccactcaca
ttccgtcccc gccgcctcac tgcagccagc
gtggccctag gacaggagga gcttcgggcc
cagcttcacc ctgcggtggg gctgaggggt
ggccatctcc tgccctgggg ccactggctt
cacattctgg gctgactcat aggggagtag
gggtggagtc accaaaacca gtgctgggac
aaagatgggg aaggtgtgtg aactttttaa
aataaacaca aaaacacagg aaaaaaaaaa
aaaaaaa
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLKLKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVG
QVNYPKVADSSSFDEDSSDALSPEQPASHESQGSVPSPLEARVSEPLLSATSASPTQVVSQLPMGRDSREMLFLAEQPPLPPPPLLPPSLTNGTTIPTAKSTPTLIKQSQPKSASE
KSQRSKKAKELKPKVKKLKYHQYIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQQHHNYQAILPAPPKSAGEALGSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNST
SLTGKPGALPANLDDMKVAELKQELKLRSLPVSGTKTELIERLRAYQDQISPVPGAPKAPAATSILHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGST
PPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKRAQQPAP
APAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPSLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLS
SGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQEGSSSQQMDDLFDILIQSGEISADFKEPPSLPGKEKPSPKTVCGSPLAAQPSPSAELP
QAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHDGPEPLSLIDDLHSQMLSSTAILDHPPSPMDTSELHFVPEPSSTMGLDLADGHLDSMDWLELSSGGPVLSLAPLSTTAPSLFS
TDFLDGHDLQLHWDSCL

Amino Acid Key
Alanine - A
Arginine - R
Asparagine - N
Aspatic Acid - D
Cysteine - C
Glutamic Acid - E
Glutamine - Q
Glycine - G
Histidine - H
Isoleucine - I
Leucine - L
Lysine - K
Methionine - M
Phenylalanine - F
Proline - P
Serine - S
Threonine - T
Tryptophan - W
Tyrosine - Y
Valine - V

Base coding provided by the NCBI Gene Mapping Database and Protein Analisys Provided by Biology Workbench